PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0025s0600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 810aa    MW: 88836.1 Da    PI: 5.151
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0025s0600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B332.41.6e-10701145399
                             EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                      B3  53 rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                              ++++r++lt+GW+ Fv +++Lk+gD+v+F   ++++ +l+v+v+r+
  SapurV1A.0025s0600.1.p  70 HRQPKRHLLTTGWSLFVGSKRLKAGDSVLFI--RNEKSQLMVGVRRA 114
                             578899*************************..5678889*****97 PP

2Auxin_resp109.63.3e-36139222183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalk.vkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             aahaa ++s+F+++YnPra++s+Fv+++ k++ka+  ++vs+GmRf m+fete+s +rr++Gt+vgvsdldp+rWp+SkWr+L+
  SapurV1A.0025s0600.1.p 139 AAHAAGNRSPFTIFYNPRACPSDFVIPLIKFRKAVFgTQVSAGMRFGMMFETEESGKRRYMGTIVGVSDLDPLRWPGSKWRNLQ 222
                             79********************************988*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.36E-1363142IPR015300DNA-binding pseudobarrel domain
PfamPF023627.0E-870114IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-1471127IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.00975115IPR003340B3 DNA binding domain
PfamPF065072.6E-31139222IPR010525Auxin response factor
PfamPF023092.5E-10687782IPR033389AUX/IAA domain
PROSITE profilePS5174526.074695779IPR000270PB1 domain
SuperFamilySSF542771.08E-8698774No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 810 aa     Download sequence    Send to blast
MGSVEEKNKP EGIVNGAHTN LLEEMKLLKE FQDQSGIRKA INSELWYACA GPLVSLPQVG  60
SLVYYFPQGH RQPKRHLLTT GWSLFVGSKR LKAGDSVLFI RNEKSQLMVG VRRANRQQTT  120
LPSSVLSADS MHIGVLAAAA HAAGNRSPFT IFYNPRACPS DFVIPLIKFR KAVFGTQVSA  180
GMRFGMMFET EESGKRRYMG TIVGVSDLDP LRWPGSKWRN LQVEWDEPGC SDRQNRVSSW  240
EIETPESLFI FPSMTSGLKR PLQSGFLGDT EWGSLVKKPL AWLPGSGNAN LPYASMSNIY  300
SEQLVNMLMK PQAVNYPEIC GTALPEVSAV KVASLDVTNV QAAVNHTSHL NNSGIMSVEN  360
QNYSQICLDQ SNAMNSSSSK ERVAGKSLYL SKVENQAPVG ILDGKLKAEP EHLPDQLSQL  420
TSTGECIVQK PFSCPMTQQN ATNHLVFQNQ NQGQSQLQTS LWPMQALPES PLLNSQQIHA  480
SLADATPPNC SLPFLDADEW ISHPMSIDSM YRSGPLSMFG LQDPMAVFPD TINPSLPLMN  540
QDAWDHQMSN LRILSQANQL IPLAQQEPCS FNSGAVKDLS DESNDQSGIY GSLNIDTSNG  600
GGSVYDRSVS SAILDEFCTF KDADLKNASD CLVGNLSSSQ DVQSQITSAS LADSQAFSRQ  660
DFPDNSGGTS SSKIEFDNSN LLHNNSWQQV APRMRTYTKV QKTGSVGRSI DVSSLKNYEQ  720
LCSAIERMFG LDGLLNNPKG SGWKLVYVDY ENDVLLIGDD PWEEFIGCVR CIRILSPSEV  780
QQMSEEGMKL LNSANIQGTN APITEDIHA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-10012475392Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300719.20.0hypothetical protein POPTR_0002s02630g
SwissprotP930240.0ARFE_ARATH; Auxin response factor 5
TrEMBLB9GQX60.0B9GQX6_POPTR; Auxin response factor
STRINGPOPTR_0002s02630.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89913241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19850.10.0ARF family protein